[Annotation] interpro scan question

[Doug howe]

Furthermore..it looks like this may be a prokaryotic signature...surely 
false positive for zebrafish then...?

Doug howe wrote:
> I've got two protein sequences (found below) which are 99% identical.  
> Both belong to zebrafish synaptosomal protein snap25a, but one of them 
> is a fragment.  The fragment turns up positive for the interpro domain 
> IPR002197 (helix-turn-helix, Fis-type), while the full length protein 
> does not.  The fragment is the only protein on the gene that is 
> positive for this interpro domain.   It turns out that IPR002197 maps 
> through interpro2go to 'transcription factor activity' and 'regulation 
> of transcription'.  Is it possible that the protein fragment is 
> getting a false positive hit for the domain IPR002197?  If so, why 
> doesn't it also make a false positive hit on the full length proteins?
>
> Any help welcomed...
>
> O93578
> LGKFCGLCSCPCNKMKSGASKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTDDAR
> ENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKM
> LGSG
>
> Q693L7
> MAEDSDMRNELADMQQRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERI
> EEGMDQINKDMKDAEKNLNDLGKFCGLCSCPCNKMKSGASKAWGNNQDGVVASQPARVVD
> EREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIM
> EKADSNKTRFDEANQRATKMLGSG
>
>

-- 
Doug Howe, Ph.D.
ZFIN Scientific Curator
Zebrafish Nomenclature Coordinator